PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000173550
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 828aa    MW: 94765.4 Da    PI: 8.1636
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000173550genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.4e-16621668148
                      TSSS-HH.HHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTte.EdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+e Ed+++++ v+++G+++W +Ia++++ gR +kqc++rw+++l
    MDP0000173550 621 KGQWTPEeEDDIIIEWVEKYGPKDWCSIAQHLP-GRIGKQCRERWHNHL 668
                      689998625789*********************.*************97 PP

2Myb_DNA-binding48.52e-15674717146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++WT+ E+  l++a++ +G+  W+ I r ++ gRt++ +k++w++
    MDP0000173550 674 KDAWTQAEEFALIRAHQIYGNQ-WAEITRFLP-GRTDNAIKNHWNN 717
                      679*****************99.*********.************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF142911.4E-3149182IPR025398Domain of unknown function DUF4371
PROSITE profilePS5129424.486616672IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-23619672IPR009057Homeodomain-like
SuperFamilySSF466897.34E-28619715IPR009057Homeodomain-like
SMARTSM007173.7E-15620670IPR001005SANT/Myb domain
PfamPF002491.8E-15621668IPR001005SANT/Myb domain
CDDcd001679.65E-15624668No hitNo description
PROSITE profilePS5129420.273673723IPR017930Myb domain
SMARTSM007177.5E-16673721IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-20673723IPR009057Homeodomain-like
PfamPF002494.5E-13674717IPR001005SANT/Myb domain
CDDcd001673.05E-11676719No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 828 aa     Download sequence    Send to blast
MKFDVLISKL GLTNRNFLSI LGLGLDHNIV DFSILGFHNF HASRPTLTVD GFNNWKRVND  60
GKNCIFLSHI GGPSSLXNTC VSRXEELMNP SQHVDKVINR QSKEEILKNR LRLKATIECX  120
RXLTFQACPF XGHDESMGSK NRGNFIELVK HTAKFNDKVA AVVLENAPKN XKYSSPMIQK  180
ELRGQGYDGA SNMRGQXXGL QSLFIKECSS AYYXHCFAHQ LQLALVAASK EVXVIWLFFS  240
TLGSIVNVIT TXPKRHTQLQ VAHTVNIEXL VGAGELETGR GANQIGTIHR PGATRWGSHY  300
DSXCDLIHMY DASCTVXENI KNDRSATNSL XXEATGAYNA IRSFEFXFIL HLLXEIMGIT  360
DILCXELQNK SQDIXNAMNL VTXTKDVLXK LRLDXWATFI DKVSLFCKKH DXDMLDMNAQ  420
YKVGTGXSCX QTXHITFEHH YHIDIFNNAI DFQLAEXNXR FXXEAMELLI LXXALEPREA  480
FKAFNIDHIC KLAXKFYSMD FTEKELHTLR YLFSNLPFLR FDLQICSVAI ASSILRLREI  540
SVLRSSKLSW VAGLVFNKVG PTIALGDYNA YESKYWRVSL CRNPVMQLDL NSTPSEELCD  600
SIQNVQVLHG RTSGPIRRST KGQWTPEEED DIIIEWVEKY GPKDWCSIAQ HLPGRIGKQC  660
RERWHNHLNP AIKKDAWTQA EEFALIRAHQ IYGNQWAEIT RFLPGRTDNA IKNHWNNSLK  720
KKLDSVKMKY YPYLKLGQGX PRELLIIVGV FFEGGESRSR LLCPAGEEGY RKCFEKVVLV  780
LVFEPHETDD NSGGRRNLEL HKSXRVIGTN LFWDQKFVQY SRDYIRDY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-416217257110B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.123070.0fruit| leaf| root| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008359529.10.0PREDICTED: zinc finger MYM-type protein 1-like
TrEMBLM5VHG71e-179M5VHG7_PRUPE; Uncharacterized protein (Fragment)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.11e-44Homeodomain-like protein